Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAP18 Rabbit Polyclonal Antibody (HRP)

SAP18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAP18P, 2HOR0202

UniProt

O00422

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAP18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep IL-23 (Interleukin 23) ValidElisa Kit
EK343724 96 Well

Sheep IL-23 (Interleukin 23) ValidElisa Kit

Sign In for Pricing
View Details
Blood Group Antigen A (CD173) (3-3A), CF740 conjugate, 0.1mg/mL
BNC741251-100 1x 100 µL

Blood Group Antigen A (CD173) (3-3A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLDN10 Rabbit Polyclonal Antibody
E10G10904 100 µL

CLDN10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein Aster-A Antibody (Fluoro488)
orb3169338 100 µg

Protein Aster-A Antibody (Fluoro488)

Sign In for Pricing
View Details
Rabbit Polyclonal MYST1 Antibody [DyLight 350]
NB100-55251UV 0.1 mL

Rabbit Polyclonal MYST1 Antibody [DyLight 350]

Sign In for Pricing
View Details
FIZ1 Double Nickase Plasmid (h)
sc-408303-NIC 20 µg

FIZ1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details