Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKZF1 Rabbit Polyclonal Antibody (HRP)

IKZF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IK1, LYF1, LyF-1, CVID13, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452

UniProt

Q13422

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IKZF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006051

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benchtop Shaking Incubator BSBT-2103
BSBT-2103 1 Unit

Benchtop Shaking Incubator BSBT-2103

Sign In for Pricing
View Details
Mouse Ang activation kit by CRISPRa
GA200183 1 Kit

Mouse Ang activation kit by CRISPRa

Sign In for Pricing
View Details
Fukutin (FKTN) (Center) Rabbit Polyclonal Antibody
AP51674PU-N 400 µL

Fukutin (FKTN) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ESAM Protein
PKSH031780 100 µg

Recombinant Human ESAM Protein

Sign In for Pricing
View Details
Fmoc-hydrazino TentaGel® TRT Resin
S30070.25G 25 g

Fmoc-hydrazino TentaGel® TRT Resin

Sign In for Pricing
View Details
Cd44 Rat Monoclonal Antibody [Clone ID: KM81]
CL023B 100 µg

Cd44 Rat Monoclonal Antibody [Clone ID: KM81]

Sign In for Pricing
View Details