Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKZF1 Rabbit Polyclonal Antibody (HRP)

IKZF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IK1, LYF1, LyF-1, CVID13, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452

UniProt

Q13422

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IKZF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006051

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ UVB 370 SE
70700-AAT 1 mg

MFluor™ UVB 370 SE

Sign In for Pricing
View Details
Atp23 (NM_026858) Mouse Tagged ORF Clone
MG202068 10 µg

Atp23 (NM_026858) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospholipase C gamma 1 (PLCG1) Human Gene Knockout Kit (CRISPR)
KN216391RB 1 Kit

Phospholipase C gamma 1 (PLCG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® PAP - TentaGel® Resin for the Synthesis of PEG Attached Peptides
J1002.1G 1 g

TentaGel® PAP - TentaGel® Resin for the Synthesis of PEG Attached Peptides

Sign In for Pricing
View Details
Human OBSCN activation kit by CRISPRa
GA113338 1 Kit

Human OBSCN activation kit by CRISPRa

Sign In for Pricing
View Details
Lawesson’s Reagent
TRC-L178780-50G 50 g

Lawesson’s Reagent

Sign In for Pricing
View Details