Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Human (His)

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-human-his.html

Purity

95.00

Smiles

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Molecular Formula

6768 (Gene_ID) NP_068813 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human GRAMD1B (NM_001286563) AAV Particle
RC239462A1V 250 µL

Human GRAMD1B (NM_001286563) AAV Particle

Ask
View Details
Human Growth Differentiation Factor 5 (GDF5) ELISA Kit
MBS2704189-01 24 Strip Well

Human Growth Differentiation Factor 5 (GDF5) ELISA Kit

Ask
View Details
Human Growth Differentiation Factor 5 (GDF5) ELISA Kit
MBS2704189-02 48 Well

Human Growth Differentiation Factor 5 (GDF5) ELISA Kit

Ask
View Details
Human Growth Differentiation Factor 5 (GDF5) ELISA Kit
MBS2704189-03 96 Well

Human Growth Differentiation Factor 5 (GDF5) ELISA Kit

Ask
View Details
Human Growth Differentiation Factor 5 (GDF5) ELISA Kit
MBS2704189-04 5x 96 Well

Human Growth Differentiation Factor 5 (GDF5) ELISA Kit

Ask
View Details
Human Growth Differentiation Factor 5 (GDF5) ELISA Kit
MBS2704189-05 10x 96 Well

Human Growth Differentiation Factor 5 (GDF5) ELISA Kit

Ask
View Details