Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Human (His)

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-human-his.html

Purity

95.00

Smiles

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Molecular Formula

6768 (Gene_ID) NP_068813 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody
abx318453-01 20 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody

Ask
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody
abx318453-02 50 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody

Ask
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody
abx318453-03 100 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody

Ask
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody
abx318453-04 200 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody

Ask
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody
abx318453-05 1 mg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody

Ask
View Details
Interleukin 22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF) (MaxLight 405) discontinued
I8443-18A-ML405 100 µL

Interleukin 22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF) (MaxLight 405) discontinued

Ask
View Details