Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Human (His)

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-human-his.html

Purity

95.00

Smiles

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Molecular Formula

6768 (Gene_ID) NP_068813 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse monoclonal mCherry antibody, HRP conjugated
TA183007 100 µL

Mouse monoclonal mCherry antibody, HRP conjugated

Ask
View Details
SNAR-E CRISPR Knock Out 293T Cell Line (Human)
44534141 1x 10^6 Cells / 1.0 mL

SNAR-E CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
Lentiviral human CIART shRNA (UAS) - Lentiviral human CIART shRNA (UAS, iRFP) (100)
GTR15328470 1 Vial

Lentiviral human CIART shRNA (UAS) - Lentiviral human CIART shRNA (UAS, iRFP) (100)

Ask
View Details
HADHB (E-1) Alexa Fluor® 546
sc-271495 AF546 200 µg/mL

HADHB (E-1) Alexa Fluor® 546

Ask
View Details
DiagPoly™ Europium Carboxylate Polystyrene Nanoparticles, 50 nm
DEC-T001 1 mL

DiagPoly™ Europium Carboxylate Polystyrene Nanoparticles, 50 nm

Ask
View Details
Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI1D5]
TA501211 100 µL

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI1D5]

Ask
View Details