Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Human (His)

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-human-his.html

Purity

95.00

Smiles

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Molecular Formula

6768 (Gene_ID) NP_068813 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLCG1 Antibody, Biotin Conjugated
MBS7133698-01 0.05 mL

PLCG1 Antibody, Biotin Conjugated

Ask
View Details
PLCG1 Antibody, Biotin Conjugated
MBS7133698-02 0.1 mL

PLCG1 Antibody, Biotin Conjugated

Ask
View Details
PLCG1 Antibody, Biotin Conjugated
MBS7133698-03 5x 0.1 mL

PLCG1 Antibody, Biotin Conjugated

Ask
View Details
XRCC5 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), X-ray Repair Complementing Defective Repair in Chinese Hamster Cells 5, 86kD Subunit of Ku Antigen, ATP Dependent DNA Helicase 2 Subunit 2, ATP-dependent DNA Helicase II, ATP-dependent DNA Helicase II 80kD Subunit, ATP-dependent DNA Helicase II 86kD Subunit, CTC Box Binding Factor 85kD, CTC85, CTCBF, DNA Repair Protein XRCC5, Double Strand Break Rejoining, FLJ39089, G22P2, Ku 80, Ku80, Ku Autoantigen 80kDa, Ku 86, Ku86, Ku86 Autoantigen-related Protein 1, KARP1, KARP-1, KUB2, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, NFIV, Thyroid Lupus Autoantigen, TLAA)
X9505-05 100 µL

XRCC5 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), X-ray Repair Complementing Defective Repair in Chinese Hamster Cells 5, 86kD Subunit of Ku Antigen, ATP Dependent DNA Helicase 2 Subunit 2, ATP-dependent DNA Helicase II, ATP-dependent DNA Helicase II 80kD Subunit, ATP-dependent DNA Helicase II 86kD Subunit, CTC Box Binding Factor 85kD, CTC85, CTCBF, DNA Repair Protein XRCC5, Double Strand Break Rejoining, FLJ39089, G22P2, Ku 80, Ku80, Ku Autoantigen 80kDa, Ku 86, Ku86, Ku86 Autoantigen-related Protein 1, KARP1, KARP-1, KUB2, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, NFIV, Thyroid Lupus Autoantigen, TLAA)

Ask
View Details
MIRacle™ hsa-miR-6722-5p miRNA Agomir/Antagomir
AM0606 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-6722-5p miRNA Agomir/Antagomir

Ask
View Details
SALL4P4 AAV Vector (Human) (CMV)
42985101 1 µg

SALL4P4 AAV Vector (Human) (CMV)

Ask
View Details