Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Matriptase/ST14 Catalytic Domain, Human (His)

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Matriptase/ST14 Catalytic Domain Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/matriptase-st14-catalytic-domain-protein-human-his.html

Purity

95.00

Smiles

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Molecular Formula

6768 (Gene_ID) NP_068813 (G596-V855) (Accession)

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAD54L2 (m) -PR
sc-152677-PR 10 µM - 20 µL

RAD54L2 (m) -PR

Ask
View Details
Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)
MBS2101701-01 5x 96 Tests

Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)

Ask
View Details
Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)
MBS2101701-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)

Ask
View Details
Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)
MBS2101701-03 10x 96 Tests

Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)

Ask
View Details
Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)
MBS2101701-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Chicken Fatty Acid Synthase (FASN) Antibody Pair Kit (with Standard)

Ask
View Details