Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORF4L1 Rabbit Polyclonal Antibody (FITC)

MORF4L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15

UniProt

Q9UBU8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORF4L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAML

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR0B2 Rabbit Polyclonal Antibody
orb511648 100 µg

NR0B2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CELA3B Antibody / Elastase 3B
V7482-100UG 100 µg

Recombinant CELA3B Antibody / Elastase 3B

Sign In for Pricing
View Details
Human FOXC2 -Forkhead Box Protein C2- CLIA Kit
E-CL-H0999-01 24 Tests

Human FOXC2 -Forkhead Box Protein C2- CLIA Kit

Sign In for Pricing
View Details
Human FOXC2 -Forkhead Box Protein C2- CLIA Kit
E-CL-H0999-02 48 Tests

Human FOXC2 -Forkhead Box Protein C2- CLIA Kit

Sign In for Pricing
View Details
Human FOXC2 -Forkhead Box Protein C2- CLIA Kit
E-CL-H0999-03 96 Tests

Human FOXC2 -Forkhead Box Protein C2- CLIA Kit

Sign In for Pricing
View Details
Human FOXC2 -Forkhead Box Protein C2- CLIA Kit
E-CL-H0999-04 5x 96 Tests

Human FOXC2 -Forkhead Box Protein C2- CLIA Kit

Sign In for Pricing
View Details