Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORF4L1 Rabbit Polyclonal Antibody (FITC)

MORF4L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15

UniProt

Q9UBU8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORF4L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAML

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC16 Peptide
orb2014433 100 µg

ZDHHC16 Peptide

Sign In for Pricing
View Details
TMEM81 Protein Vector (Mouse) (pPM-C-HA)
PV239876 500 ng

TMEM81 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PARP16, CT (PARP16, C15orf30, Poly [ADP-ribose] polymerase 16, ADP-ribosyltransferase diphtheria toxin-like 15) (MaxLight 550)
MBS6330974-01 0.1 mL

PARP16, CT (PARP16, C15orf30, Poly [ADP-ribose] polymerase 16, ADP-ribosyltransferase diphtheria toxin-like 15) (MaxLight 550)

Sign In for Pricing
View Details
PARP16, CT (PARP16, C15orf30, Poly [ADP-ribose] polymerase 16, ADP-ribosyltransferase diphtheria toxin-like 15) (MaxLight 550)
MBS6330974-02 5x 0.1 mL

PARP16, CT (PARP16, C15orf30, Poly [ADP-ribose] polymerase 16, ADP-ribosyltransferase diphtheria toxin-like 15) (MaxLight 550)

Sign In for Pricing
View Details
ASNA1 siRNA (Mouse)
CRM5835-01 15 nmol

ASNA1 siRNA (Mouse)

Sign In for Pricing
View Details
ASNA1 siRNA (Mouse)
CRM5835-02 30 nmol

ASNA1 siRNA (Mouse)

Sign In for Pricing
View Details