Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORF4L1 Rabbit Polyclonal Antibody (HRP)

MORF4L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15

UniProt

Q9UBU8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORF4L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAML

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A10 Rabbit Polyclonal Antibody
orb402277 100 µg

S100A10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid
229659-01 100 mg

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid

Sign In for Pricing
View Details
2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid
229659-02 250 mg

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid

Sign In for Pricing
View Details
2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid
229659-03 1 g

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid

Sign In for Pricing
View Details
Rabbit anti Dog IgA (Fc specific)
RAD/IgA(Fc) 1 mL

Rabbit anti Dog IgA (Fc specific)

Sign In for Pricing
View Details
Bovine Dipeptidyl peptidase 1, CTSC ELISA KIT
ELI-07452b 96 Tests

Bovine Dipeptidyl peptidase 1, CTSC ELISA KIT

Sign In for Pricing
View Details