Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS5 Rabbit Polyclonal Antibody (HRP)

COPS5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CSN5, JAB1, SGN5, MOV-34

UniProt

Q92905

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human COPS5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit
MBS7261554-01 48 Well

Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit
MBS7261554-02 96 Well

Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit
MBS7261554-03 5x 96 Well

Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit

Sign In for Pricing
View Details
Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit
MBS7261554-04 10x 96 Well

Canine Anti-Agrin Antibody (AGR-Ab) ELISA Kit

Sign In for Pricing
View Details
Von Hippel Lindau Tumor Suppressor (vHL) Monoclonal Antibody
CAU35006-01 100 µL

Von Hippel Lindau Tumor Suppressor (vHL) Monoclonal Antibody

Sign In for Pricing
View Details
Von Hippel Lindau Tumor Suppressor (vHL) Monoclonal Antibody
CAU35006-02 200 µL

Von Hippel Lindau Tumor Suppressor (vHL) Monoclonal Antibody

Sign In for Pricing
View Details