Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPK3 Rabbit Polyclonal Antibody (HRP)

RIPK3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIP3

UniProt

Q9Y572

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD147 Antibody
E18-0428-1 50 µg - 50 µL

CD147 Antibody

Sign In for Pricing
View Details
NUP54 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
32335064 1.0 µg DNA

NUP54 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit
orb777632-01 48 Tests

Human Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit
orb777632-02 96 Tests

Human Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit

Sign In for Pricing
View Details
Anti-PVRIG Monoclonal Antibody
B2014657 10 µL

Anti-PVRIG Monoclonal Antibody

Sign In for Pricing
View Details
C4orf14 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-9992R-APC-Cy5.5 100 µL

C4orf14 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details