Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Cynomolgus (HEK293, His)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 132 amino acids (G24­A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

GIAIPRNSGCPNSEDKNFPRTVMVNLNIHNRNTSTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVKADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Molecular Formula

102119976 (Gene_ID) XP_005552816 (G24-A155) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-500 1x 500 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laminin (A5), CF740 conjugate, 0.1mg/mL
BNC740308-100 1x 100 µL

Laminin (A5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (SY5), CF594 conjugate, 0.1mg/mL
BNC940678-500 1x 500 µL

Involucrin (SY5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), CF594 conjugate, 0.1mg/mL
BNC942908-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2908R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC042562-500 1x 500 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details