Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SALF Rabbit Polyclonal Antibody (Biotin)

SALF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALF, SALF, GTF2A1L, GTF2A1LF

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SALF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_758515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)
MBS2101954-01 5x 96 Tests

Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)
MBS2101954-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)
MBS2101954-03 10x 96 Tests

Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)
MBS2101954-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Oxysterol Binding Protein (OSBP) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
IL-1 beta Rabbit mAb
orb2707095-01 20 ul

IL-1 beta Rabbit mAb

Sign In for Pricing
View Details
IL-1 beta Rabbit mAb
orb2707095-02 50 µL

IL-1 beta Rabbit mAb

Sign In for Pricing
View Details