Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prdm4 Rabbit Polyclonal Antibody (HRP)

Prdm4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SC, SC-, SC1, SC-1, AW552272, 1700031E19Rik, 2810470D21Rik

UniProt

Q80V63

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prdm4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_857633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, p62, p68, Sam68) (AP)
MBS6423801-01 0.1 mL

KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, p62, p68, Sam68) (AP)

Sign In for Pricing
View Details
KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, p62, p68, Sam68) (AP)
MBS6423801-02 5x 0.1 mL

KHDRBS1 (KH Domain-containing, RNA-binding, Signal Transduction-associated Protein 1, p62, p68, Sam68) (AP)

Sign In for Pricing
View Details
Lentiviral human LSR shRNA (UAS) - Lentiviral human LSR shRNA (UAS, iRFP) (100)
GTR15142539 1 Vial

Lentiviral human LSR shRNA (UAS) - Lentiviral human LSR shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
1- (2,6-diisopropylphenyl) -3- (2-morpholin-4-yl-5- (trifluoromethyl) phenyl) urea
UUB39214 250 mg

1- (2,6-diisopropylphenyl) -3- (2-morpholin-4-yl-5- (trifluoromethyl) phenyl) urea

Sign In for Pricing
View Details
Fyttd1 ORF Vector (Rat) (pORF)
ORF067320 1.0 µg DNA

Fyttd1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PLAC8 Rabbit Polyclonal Antibody (Fluoro550)
orb3094874 100 µg

PLAC8 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details