Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX21 Rabbit Polyclonal Antibody (HRP)

SOX21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOX25

UniProt

Q9Y651

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SOX21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009015

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031967 96 Tests

Multiplex Assay Kit for Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Terbinafine Hydrochloride
TRC-T107500-100MG 100 mg

Terbinafine Hydrochloride

Sign In for Pricing
View Details
ATRIP Protein Vector (Human) (pPM-C-HA)
12834021 500 ng

ATRIP Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NECAP2 Blocking Peptide
33R-9994 0.1 mg

NECAP2 Blocking Peptide

Sign In for Pricing
View Details
Rat Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit
MBS2700575-01 24 Strip Well

Rat Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details
Rat Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit
MBS2700575-02 48 Well

Rat Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details