Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMF1 Rabbit Polyclonal Antibody (FITC)

PMF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6P1K2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PMF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Mediator of RNA polymerase II transcription subunit 14 (MED14) ELISA Kit
GTR10346111 96 Well

Canine Mediator of RNA polymerase II transcription subunit 14 (MED14) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal AMSH/STAMBP Antibody [Alexa Fluor 594]
NBP2-97315AF594 0.1 mL

Rabbit Polyclonal AMSH/STAMBP Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Dynamin Inhibitor I, Dynasore
TRC-D826508-10MG 10 mg

Dynamin Inhibitor I, Dynasore

Sign In for Pricing
View Details
Recombinant Human Lymphocyte transmembrane adapter 1 (LAX1), partial
MBS7092984 0.05 mg (Yeast)

Recombinant Human Lymphocyte transmembrane adapter 1 (LAX1), partial

Sign In for Pricing
View Details
LIN7 (LIN7A) (NM_004664) Human Recombinant Protein
E45H34339M5 20 µg

LIN7 (LIN7A) (NM_004664) Human Recombinant Protein

Sign In for Pricing
View Details
PRRT1 AAV Vector (Human) (CMV)
37820101 1 µg

PRRT1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details