Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMF1 Rabbit Polyclonal Antibody (Biotin)

PMF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6P1K2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PMF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF313 (Zinc Finger Protein 313, RING Finger Protein 114, RNF114, Zinc Finger Protein 228, ZNF228, PSORS12) (Biotin)
135687-Biotin 100 µL

ZNF313 (Zinc Finger Protein 313, RING Finger Protein 114, RNF114, Zinc Finger Protein 228, ZNF228, PSORS12) (Biotin)

Sign In for Pricing
View Details
ADAM23, CT (ADAM23, MDC3, Disintegrin and metalloproteinase domain-containing protein 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (MaxLight 405)
MBS6271524-01 0.1 mL

ADAM23, CT (ADAM23, MDC3, Disintegrin and metalloproteinase domain-containing protein 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (MaxLight 405)

Sign In for Pricing
View Details
ADAM23, CT (ADAM23, MDC3, Disintegrin and metalloproteinase domain-containing protein 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (MaxLight 405)
MBS6271524-02 5x 0.1 mL

ADAM23, CT (ADAM23, MDC3, Disintegrin and metalloproteinase domain-containing protein 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (MaxLight 405)

Sign In for Pricing
View Details
EVC2 Polyclonal Antibody
MBS2519106-01 0.02 mL

EVC2 Polyclonal Antibody

Sign In for Pricing
View Details
EVC2 Polyclonal Antibody
MBS2519106-02 0.06 mL

EVC2 Polyclonal Antibody

Sign In for Pricing
View Details
EVC2 Polyclonal Antibody
MBS2519106-03 0.12 mL

EVC2 Polyclonal Antibody

Sign In for Pricing
View Details