Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU6F2 Rabbit Polyclonal Antibody (FITC)

POU6F2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WT5, WTSL, RPF-1

UniProt

P78424

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU6F2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100503457 3'UTR Luciferase Stable Cell Line
TU111815 1.0 mL

LOC100503457 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human KYNU Protein, N-His
HS716012-01 50 µg

Recombinant Human KYNU Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KYNU Protein, N-His
HS716012-02 100 µg

Recombinant Human KYNU Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KYNU Protein, N-His
HS716012-03 1 mg

Recombinant Human KYNU Protein, N-His

Sign In for Pricing
View Details
Stromal Cell Derived Factor 1 alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (APC)
MBS6501336-01 0.1 mL

Stromal Cell Derived Factor 1 alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (APC)

Sign In for Pricing
View Details
Stromal Cell Derived Factor 1 alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (APC)
MBS6501336-02 5x 0.1 mL

Stromal Cell Derived Factor 1 alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (APC)

Sign In for Pricing
View Details