Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXP4 Rabbit Polyclonal Antibody (FITC)

FOXP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HFKHLA

UniProt

Q8IW55

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGD2 cDNA Clone
MBS1265819-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

FGD2 cDNA Clone

Sign In for Pricing
View Details
FGD2 cDNA Clone
MBS1265819-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

FGD2 cDNA Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Ago2/eIF2C2 Antibody [Janelia Fluor 646]
NBP2-99647JF646 0.1 mL

Rabbit Polyclonal Ago2/eIF2C2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Hepatitis C HCV NS5 Genotype-3 Protein, GST, E.coli-500ug
QP12192-500ug 500ug

Recombinant Hepatitis C HCV NS5 Genotype-3 Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
Siglec 6, CT (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (APC) discontinued
S1013-59P-APC 200 µL

Siglec 6, CT (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (APC) discontinued

Sign In for Pricing
View Details
SATB2 Adenovirus (Mouse)
43040054 1.0 mL

SATB2 Adenovirus (Mouse)

Sign In for Pricing
View Details