Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXP4 Rabbit Polyclonal Antibody (Biotin)

FOXP4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HFKHLA

UniProt

Q8IW55

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXP4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RANGAP1 Antibody Picoband® (Dylight488 Conjugate)
A02771-2-Dylight488 100 µg

Anti-RANGAP1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Interleukin 33 (IL-33, C9orf26, DKFZp586H0523, DVS27, IL1F11, IL-1F11, Interleukin-1 Family Member 11, Interleukin-33, NFEHEV, NFHEV, NF-HEV, Nuclear Factor from High Endothelial Venules, RP11-575C20.2) (MaxLight 750)
MBS6482620-01 0.1 mL

Interleukin 33 (IL-33, C9orf26, DKFZp586H0523, DVS27, IL1F11, IL-1F11, Interleukin-1 Family Member 11, Interleukin-33, NFEHEV, NFHEV, NF-HEV, Nuclear Factor from High Endothelial Venules, RP11-575C20.2) (MaxLight 750)

Sign In for Pricing
View Details
Interleukin 33 (IL-33, C9orf26, DKFZp586H0523, DVS27, IL1F11, IL-1F11, Interleukin-1 Family Member 11, Interleukin-33, NFEHEV, NFHEV, NF-HEV, Nuclear Factor from High Endothelial Venules, RP11-575C20.2) (MaxLight 750)
MBS6482620-02 5x 0.1 mL

Interleukin 33 (IL-33, C9orf26, DKFZp586H0523, DVS27, IL1F11, IL-1F11, Interleukin-1 Family Member 11, Interleukin-33, NFEHEV, NFHEV, NF-HEV, Nuclear Factor from High Endothelial Venules, RP11-575C20.2) (MaxLight 750)

Sign In for Pricing
View Details
PBS (1X, premixed powder)
ST447-5L 5x 1L

PBS (1X, premixed powder)

Sign In for Pricing
View Details
Protein Gene Product 9.5 (PGP9.5, UchL1, Ubiquitin C-terminal Hydrolase, PARK5) (Biotin)
138590-AF-Biotin 100 µL

Protein Gene Product 9.5 (PGP9.5, UchL1, Ubiquitin C-terminal Hydrolase, PARK5) (Biotin)

Sign In for Pricing
View Details
H5 (H5N1) (A/Vietnam/1203/2004)
IT-003-0051p-01 0.1 mg

H5 (H5N1) (A/Vietnam/1203/2004)

Sign In for Pricing
View Details