Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4930567H17Rik Rabbit Polyclonal Antibody (FITC)

4930567H17Rik Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q3V0K5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028979

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prevotella intermedia
LBST-008FG 200 µg

Prevotella intermedia

Sign In for Pricing
View Details
GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)
MBS6152807-01 0.1 mL

GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)

Sign In for Pricing
View Details
GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)
MBS6152807-02 5x 0.1 mL

GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)

Sign In for Pricing
View Details
Recombinant Clonorchis sinensis Tropomyosin
MBS1296354-01 0.02 mg (E-Coli)

Recombinant Clonorchis sinensis Tropomyosin

Sign In for Pricing
View Details
Recombinant Clonorchis sinensis Tropomyosin
MBS1296354-02 0.02 mg (Yeast)

Recombinant Clonorchis sinensis Tropomyosin

Sign In for Pricing
View Details
Recombinant Clonorchis sinensis Tropomyosin
MBS1296354-03 0.1 mg (E-Coli)

Recombinant Clonorchis sinensis Tropomyosin

Sign In for Pricing
View Details