Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC19 Rabbit Polyclonal Antibody (Biotin)

ZDHHC19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DHHC19

UniProt

Q8WVZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZDHHC19

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MARCHF3 shRNA (UAS) - Lentiviral human MARCHF3 shRNA (UAS, RFP) (25)
GTR15313070 1 Vial

Lentiviral human MARCHF3 shRNA (UAS) - Lentiviral human MARCHF3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PSME1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61868R-BF405-01 20 µL

PSME1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
PSME1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61868R-BF405-02 100 µL

PSME1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
B3GAT3 Protein Vector (Human) (pPB-His-MBP)
PV325930 500 ng

B3GAT3 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (HRP) discontinued
S1013-57E7-HRP 100 µL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (HRP) discontinued

Sign In for Pricing
View Details
MYH10 (Myosin-10, Myosin, Heavy Chain 10, Non-Muscle)
486403 100 µL

MYH10 (Myosin-10, Myosin, Heavy Chain 10, Non-Muscle)

Sign In for Pricing
View Details