Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F2 Rabbit Polyclonal Antibody (FITC)

E2F2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E2F-2

UniProt

Q14209

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human E2F2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004082

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EpCAM/TROP1 Antibody (EGP40/1120) [PE/Atto594]
NBP2-47874PEATT594 0.1 mL

Mouse Monoclonal EpCAM/TROP1 Antibody (EGP40/1120) [PE/Atto594]

Sign In for Pricing
View Details
PPP2R2B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B, beta isoform, B55-BETA, FLJ95686, MGC24888, PP2A-B55BETA, PP2A-PR55B, PP2AB-BETA, PP2APR55-BETA, PR2AB-BETA, PR2AB55-BETA, PR2APR55-BETA, PR52B, PR55-BETA, SCA12) (MaxLight 405) discontinued
250405-ML405 100 µL

PPP2R2B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B, beta isoform, B55-BETA, FLJ95686, MGC24888, PP2A-B55BETA, PP2A-PR55B, PP2AB-BETA, PP2APR55-BETA, PR2AB-BETA, PR2AB55-BETA, PR2APR55-BETA, PR52B, PR55-BETA, SCA12) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Stat1 (NM_001034164) Rat Tagged ORF Clone Lentiviral Particle
RR200448L3V 200 µL

Stat1 (NM_001034164) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Histone H2B Monoclonal Antibody, Cy5.5 Conjugated
bsm-33174M-Cy5.5 100 µL

Histone H2B Monoclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)
MBS6227557-01 0.1 mL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)
MBS6227557-02 5x 0.1 mL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)

Sign In for Pricing
View Details