Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF1 Rabbit Polyclonal Antibody (HRP)

EBF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EBF, COE1, OLF1, O/E-1

UniProt

Q9UH73

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EBF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slotted Masses Set, Cast Iron
2013360/5 1 Each

Slotted Masses Set, Cast Iron

Sign In for Pricing
View Details
Beta Amyloid 1-40 Mouse Polyclonal Antibody (BF350)
orb2559896 100 µL

Beta Amyloid 1-40 Mouse Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
TNIP1, CT (TNIP1, KIAA0113, NAF1, TNFAIP3-interacting protein 1, A20-binding inhibitor of NF-kappa-B activation 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Nip40-1, Virion-associated nuclear shuttling protein) (FITC)
MBS6357090-01 0.2 mL

TNIP1, CT (TNIP1, KIAA0113, NAF1, TNFAIP3-interacting protein 1, A20-binding inhibitor of NF-kappa-B activation 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Nip40-1, Virion-associated nuclear shuttling protein) (FITC)

Sign In for Pricing
View Details
TNIP1, CT (TNIP1, KIAA0113, NAF1, TNFAIP3-interacting protein 1, A20-binding inhibitor of NF-kappa-B activation 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Nip40-1, Virion-associated nuclear shuttling protein) (FITC)
MBS6357090-02 5x 0.2 mL

TNIP1, CT (TNIP1, KIAA0113, NAF1, TNFAIP3-interacting protein 1, A20-binding inhibitor of NF-kappa-B activation 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Nip40-1, Virion-associated nuclear shuttling protein) (FITC)

Sign In for Pricing
View Details
Human Pro-Matrix Metalloproteinase 10 Chemiluminescent Immunoassay Kit
IHUPROMMP10KTC 1 Each

Human Pro-Matrix Metalloproteinase 10 Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
MAPK1 Antibody (C-term) [APR08321G]
APR08321G-01 50 µL

MAPK1 Antibody (C-term) [APR08321G]

Sign In for Pricing
View Details