Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rcan1 Rabbit Polyclonal Antibody (HRP)

Rcan1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dscr1, Mcip1

UniProt

Q6IN33

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rcan1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAAD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

EDM10766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntrophin alpha 1 Rabbit Monoclonal Antibody
E10G22067 100 µL

Syntrophin alpha 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Arf1 (NM_022518) Rat Tagged ORF Clone
RR202658 10 µg

Arf1 (NM_022518) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human CA11 Recombinant Protein
PROTO75493-01 20 µg

Human CA11 Recombinant Protein

Sign In for Pricing
View Details
Human CA11 Recombinant Protein
PROTO75493-02 500 µg

Human CA11 Recombinant Protein

Sign In for Pricing
View Details
SSH1 (slingshot Homolog 1 (Drosophila), FLJ38102, KIAA1298, SSH-1) (FITC)
MBS6178489-01 0.1 mL

SSH1 (slingshot Homolog 1 (Drosophila), FLJ38102, KIAA1298, SSH-1) (FITC)

Sign In for Pricing
View Details
SSH1 (slingshot Homolog 1 (Drosophila), FLJ38102, KIAA1298, SSH-1) (FITC)
MBS6178489-02 5x 0.1 mL

SSH1 (slingshot Homolog 1 (Drosophila), FLJ38102, KIAA1298, SSH-1) (FITC)

Sign In for Pricing
View Details