Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHR Rabbit Polyclonal Antibody (HRP)

AHR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP85, bHLHe76

UniProt

P35869

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AHR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001612

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Sodium Iodide Symporter (NIS)
FY-AB45407-01 1 mL

Anti-Sodium Iodide Symporter (NIS)

Sign In for Pricing
View Details
Anti-Sodium Iodide Symporter (NIS)
FY-AB45407-02 100 µL

Anti-Sodium Iodide Symporter (NIS)

Sign In for Pricing
View Details
Anti-Sodium Iodide Symporter (NIS)
FY-AB45407-03 200 µL

Anti-Sodium Iodide Symporter (NIS)

Sign In for Pricing
View Details
Phospho-LRP5 (Thr1492) Rabbit Polyclonal Antibody (PE)
orb2438567 100 µL

Phospho-LRP5 (Thr1492) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Bovine Olfactory receptor 14K1 (OR5AY1) ELISA Kit
GTR10364553 96 Well

Bovine Olfactory receptor 14K1 (OR5AY1) ELISA Kit

Sign In for Pricing
View Details
DLX3 Antibody Blocking Peptide
orb1512444 500 µg

DLX3 Antibody Blocking Peptide

Sign In for Pricing
View Details