Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF4 Rabbit Polyclonal Antibody (HRP)

ELF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MEF, ELFR

UniProt

Q99607

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001412

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSD Peptide - C-terminal region
orb1999474 100 µg

ARSD Peptide - C-terminal region

Sign In for Pricing
View Details
Anti-Thrombomodulin Antibody (5U850)
TMAC-04032-01 50 μL

Anti-Thrombomodulin Antibody (5U850)

Sign In for Pricing
View Details
Anti-Thrombomodulin Antibody (5U850)
TMAC-04032-02 100 µL

Anti-Thrombomodulin Antibody (5U850)

Sign In for Pricing
View Details
Human Delta Like Protein 1 (dLL1) ELISA Kit
TRV-0002895 96 Well Plate

Human Delta Like Protein 1 (dLL1) ELISA Kit

Sign In for Pricing
View Details
Myosin Light Chain Kinase 3, NT (MYLK3, MLCK2, MLCK, caMLCK, Cardiac-MyBP-C-associated Ca/CaM Kinase, MGC126319, MGC126320, Putative Myosin Light Chain Kinase 3) (MaxLight 490)
MBS6489136-01 0.1 mL

Myosin Light Chain Kinase 3, NT (MYLK3, MLCK2, MLCK, caMLCK, Cardiac-MyBP-C-associated Ca/CaM Kinase, MGC126319, MGC126320, Putative Myosin Light Chain Kinase 3) (MaxLight 490)

Sign In for Pricing
View Details
Myosin Light Chain Kinase 3, NT (MYLK3, MLCK2, MLCK, caMLCK, Cardiac-MyBP-C-associated Ca/CaM Kinase, MGC126319, MGC126320, Putative Myosin Light Chain Kinase 3) (MaxLight 490)
MBS6489136-02 5x 0.1 mL

Myosin Light Chain Kinase 3, NT (MYLK3, MLCK2, MLCK, caMLCK, Cardiac-MyBP-C-associated Ca/CaM Kinase, MGC126319, MGC126320, Putative Myosin Light Chain Kinase 3) (MaxLight 490)

Sign In for Pricing
View Details