Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSX1 Rabbit Polyclonal Antibody (HRP)

GSX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GSH1, Gsh-1

UniProt

Q9H4S2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GSX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHAR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Utrn (NM_013070) Rat Tagged ORF Clone
RR203926 10 µg

Utrn (NM_013070) Rat Tagged ORF Clone

Sign In for Pricing
View Details
CLIA Kit for Immunoglobulin E (IgE)
TRV-0049851-01 24 Tests

CLIA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
CLIA Kit for Immunoglobulin E (IgE)
TRV-0049851-02 48 Tests

CLIA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
CLIA Kit for Immunoglobulin E (IgE)
TRV-0049851-03 96 Tests

CLIA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
CLIA Kit for Immunoglobulin E (IgE)
TRV-0049851-04 5x 96 Tests

CLIA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
CLIA Kit for Immunoglobulin E (IgE)
TRV-0049851-05 10x 96 Tests

CLIA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details