Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF25 Rabbit Polyclonal Antibody (HRP)

ZNF25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Zfp9, KOX19

UniProt

P17030

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFCQKSALIVHQHTH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

XP_005252443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrin Releasing Peptide Antibody
DF13618-01 100 µL

Gastrin Releasing Peptide Antibody

Sign In for Pricing
View Details
Gastrin Releasing Peptide Antibody
DF13618-02 200 µL

Gastrin Releasing Peptide Antibody

Sign In for Pricing
View Details
CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (Biotin)
244505-Biotin 100 µL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (Biotin)

Sign In for Pricing
View Details
Bovine Complement component C4 (C4) ELISA Kit
orb2812054-01 48 Tests

Bovine Complement component C4 (C4) ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component C4 (C4) ELISA Kit
orb2812054-02 96 Tests

Bovine Complement component C4 (C4) ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component C4 (C4) ELISA Kit
orb2812054-03 5 x 96 T

Bovine Complement component C4 (C4) ELISA Kit

Sign In for Pricing
View Details