Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF25 Rabbit Polyclonal Antibody (HRP)

ZNF25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Zfp9, KOX19

UniProt

P17030

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFCQKSALIVHQHTH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

XP_005252443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTP4, CT (RTP4, IFRG28, Receptor-transporting protein 4, 28kD interferon-responsive protein) (AP) discontinued
041329-AP 200 µL

RTP4, CT (RTP4, IFRG28, Receptor-transporting protein 4, 28kD interferon-responsive protein) (AP) discontinued

Sign In for Pricing
View Details
PCDH1, NT (PCDH1, Protocadherin-1, Cadherin-like protein 1, Protocadherin-42) (FITC)
MBS6331355-01 0.2 mL

PCDH1, NT (PCDH1, Protocadherin-1, Cadherin-like protein 1, Protocadherin-42) (FITC)

Sign In for Pricing
View Details
PCDH1, NT (PCDH1, Protocadherin-1, Cadherin-like protein 1, Protocadherin-42) (FITC)
MBS6331355-02 5x 0.2 mL

PCDH1, NT (PCDH1, Protocadherin-1, Cadherin-like protein 1, Protocadherin-42) (FITC)

Sign In for Pricing
View Details
Graduated cylinder, 25mL, PP
602561-1 1 Each

Graduated cylinder, 25mL, PP

Sign In for Pricing
View Details
Cort Rat Pre-designed siRNA Set A
HY-RS23250 1 Set

Cort Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
PSCA Antibody
CSB-PA587709-01 50 μL

PSCA Antibody

Sign In for Pricing
View Details