Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF365 Rabbit Polyclonal Antibody (FITC)

ZNF365 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UAN, Su48, ZNF365D

UniProt

Q70YC5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), 0.2mg/mL
BNUB2467-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), 0.2mg/mL

Sign In for Pricing
View Details
CD95 (FAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C2]
TA506937BM 100 µL

CD95 (FAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C2]

Sign In for Pricing
View Details
AGRP (C-term) Goat Polyclonal Antibody
AP32076PU-N 100 µg

AGRP (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat VEGF-A
6510 5 µg

Recombinant Rat VEGF-A

Sign In for Pricing
View Details
PNCK Human Gene Knockout Kit (CRISPR)
KN221855LP 1 Kit

PNCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ngf Mouse Gene Knockout Kit (CRISPR)
KN310963LP 1 Kit

Ngf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details