Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCMH1 Rabbit Polyclonal Antibody (FITC)

SCMH1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Scml3

UniProt

Q96GD3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SCMH1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_036368

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-301b-5p Vector
mh41720 500 ng

LentimiRa-hsa-miR-301b-5p Vector

Sign In for Pricing
View Details
FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
TRV-0020520-01 50 Tests

FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
TRV-0020520-02 100 Tests

FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
TRV-0020520-03 200 Tests

FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody

Sign In for Pricing
View Details
Streptavidin Amca Conjugated
orb348771 1 mg

Streptavidin Amca Conjugated

Sign In for Pricing
View Details
Lentiviral human KAZALD1 shRNA (UAS) - Lentiviral human KAZALD1 shRNA (UAS, GFP) (25)
GTR15159368 1 Vial

Lentiviral human KAZALD1 shRNA (UAS) - Lentiviral human KAZALD1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details