Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Rabbit Polyclonal Antibody (FITC)

RAD51 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930

UniProt

Q06609

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8D9]
TA500783AM 100 µL

AKT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8D9]

Sign In for Pricing
View Details
CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]
AM03117PU-N 100 µL

CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]

Sign In for Pricing
View Details
Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-p-01 96 Tests

Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-p-02 48 Tests

Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Cntnap1 Mouse Gene Knockout Kit (CRISPR)
KN503587 1 Kit

Cntnap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF640R conjugate, 0.1mg/mL
BNC402190-100 1x 100 µL

Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details