Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX1 Rabbit Polyclonal Antibody (HRP)

SOX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOX1

UniProt

O00570

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAA

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hddc2 (NM_001108460) Rat Tagged ORF Clone Lentiviral Particle
RR201596L4V 200 µL

Hddc2 (NM_001108460) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Fam219a shRNA (UAS) - Lentiviral mouse Fam219a shRNA (UAS, GFP) (100)
GTR15177045 1 Vial

Lentiviral mouse Fam219a shRNA (UAS) - Lentiviral mouse Fam219a shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human FGF basic (154aa) Protein, premium grade
BFF-H5115-50ug 50 µg

Human FGF basic (154aa) Protein, premium grade

Sign In for Pricing
View Details
Chicken POU domain, class 5, transcription factor 1 (POU5F1) ELISA kit
GTR10379342 96 Well

Chicken POU domain, class 5, transcription factor 1 (POU5F1) ELISA kit

Sign In for Pricing
View Details
GENLISA Mouse Integrin Linked Kinase (ILK) ELISA
KLM3743 1x 96 Well

GENLISA Mouse Integrin Linked Kinase (ILK) ELISA

Sign In for Pricing
View Details
CIRE antibody (FITC)
61R-1132 100 ug

CIRE antibody (FITC)

Sign In for Pricing
View Details