Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX2 Rabbit Polyclonal Antibody (FITC)

SOX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ANOP3, MCOPS3

UniProt

P48431

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003097

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dextran Axonal Tracer 10,000 MW, CF®680R Conjugate
81-1018 1 mg

Dextran Axonal Tracer 10,000 MW, CF®680R Conjugate

Sign In for Pricing
View Details
Spike Protein (C-His, SARS-CoV-2)
P528707 100 µg

Spike Protein (C-His, SARS-CoV-2)

Sign In for Pricing
View Details
RPL12, Recombinant, Human, aa1-165, His-Tag (Ribosomal Protein L12, L12)
137190 50 µg

RPL12, Recombinant, Human, aa1-165, His-Tag (Ribosomal Protein L12, L12)

Sign In for Pricing
View Details
Reagecon pH 13.00 Buffer Solution at 25°C
113025 1 L

Reagecon pH 13.00 Buffer Solution at 25°C

Sign In for Pricing
View Details
HAND1, ID (HAND1, BHLHA27, EHAND, Heart-and neural crest derivatives-expressed protein 1, Class A basic helix-loop-helix protein 27, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (APC)
MBS6305373-01 0.2 mL

HAND1, ID (HAND1, BHLHA27, EHAND, Heart-and neural crest derivatives-expressed protein 1, Class A basic helix-loop-helix protein 27, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (APC)

Sign In for Pricing
View Details
HAND1, ID (HAND1, BHLHA27, EHAND, Heart-and neural crest derivatives-expressed protein 1, Class A basic helix-loop-helix protein 27, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (APC)
MBS6305373-02 5x 0.2 mL

HAND1, ID (HAND1, BHLHA27, EHAND, Heart-and neural crest derivatives-expressed protein 1, Class A basic helix-loop-helix protein 27, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (APC)

Sign In for Pricing
View Details