Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fkhl18 Rabbit Polyclonal Antibody (HRP)

Fkhl18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fkh3, FREAC, Fkhl1, Fkhl18, FREAC10

UniProt

Q61574

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034356

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF740 conjugate, 0.1mg/mL
BNC742085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HMGN3 (N-term) Rabbit Polyclonal Antibody
AP52062PU-N 400 µL

HMGN3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DL-threo-Droxidopa-d3 Hydrochloride Salt Hydrate
TRC-D689954-2.5MG 2.5 mg

DL-threo-Droxidopa-d3 Hydrochloride Salt Hydrate

Sign In for Pricing
View Details
DNA Polymerase beta (POLB) (NM_002690) Human Over-expression Lysate
LY419169 100 µg

DNA Polymerase beta (POLB) (NM_002690) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS712062 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
Fluo -4 K+ Salt - Green fluorescent calcium indicator
1042C 500 µg

Fluo -4 K+ Salt - Green fluorescent calcium indicator

Sign In for Pricing
View Details