Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D2B Rabbit Polyclonal Antibody (FITC)

TBC1D2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ20166, KIAA1055

UniProt

Q9UPU7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit A (nuoA)
orb2932276-01 20 µg

Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit A (nuoA)
orb2932276-02 100 µg

Recombinant Chromohalobacter salexigens NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details
BCAS2, Recombinant, Human, aa1-225, GST-Tag (Pre-mRNA-splicing Factor SPF27)
372415-01 20 µg

BCAS2, Recombinant, Human, aa1-225, GST-Tag (Pre-mRNA-splicing Factor SPF27)

Sign In for Pricing
View Details
BCAS2, Recombinant, Human, aa1-225, GST-Tag (Pre-mRNA-splicing Factor SPF27)
372415-02 100 µg

BCAS2, Recombinant, Human, aa1-225, GST-Tag (Pre-mRNA-splicing Factor SPF27)

Sign In for Pricing
View Details
BCAS2, Recombinant, Human, aa1-225, GST-Tag (Pre-mRNA-splicing Factor SPF27)
372415-03 1 mg

BCAS2, Recombinant, Human, aa1-225, GST-Tag (Pre-mRNA-splicing Factor SPF27)

Sign In for Pricing
View Details
4- ((2-ethylidene-4-hydroxy-6-methylhept-5-en-1-yl) oxy) -bergaptol
AB1064 10 mg

4- ((2-ethylidene-4-hydroxy-6-methylhept-5-en-1-yl) oxy) -bergaptol

Sign In for Pricing
View Details