Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L2 Rabbit Polyclonal Antibody (HRP)

SEC14L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPF, TAP, TAP1, C22orf6

UniProt

O76054

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEC14L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAb to CA72-4
MBS313295-01 1 mg

MAb to CA72-4

Sign In for Pricing
View Details
MAb to CA72-4
MBS313295-02 5x 1 mg

MAb to CA72-4

Sign In for Pricing
View Details
MFluor™ Red 700 Anti-human CD268 Antibody *11C1*
126800V1-AAT 500 Tests

MFluor™ Red 700 Anti-human CD268 Antibody *11C1*

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial
MBS1171248-01 1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial
MBS1171248-02 1 mg (Yeast)

Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial

Sign In for Pricing
View Details
Lentiviral mouse Klf14 shRNA (UAS) - Lentiviral mouse Klf14 shRNA (UAS, iRFP) plasmid
GTR15193204 1 Vial

Lentiviral mouse Klf14 shRNA (UAS) - Lentiviral mouse Klf14 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details