Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L2 Rabbit Polyclonal Antibody (Biotin)

SEC14L2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPF, TAP, TAP1, C22orf6

UniProt

O76054

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEC14L2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADHFE1 sgRNA gene knockout kit - Lentiviral human ADHFE1 sgRNA gene knockout kit (plasmid)
GTR15394610 1 Vial

Lentiviral human ADHFE1 sgRNA gene knockout kit - Lentiviral human ADHFE1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
FGD3, CT (FGD3, ZFYVE5, FYVE, RhoGEF and PH domain-containing protein 3, Zinc finger FYVE domain-containing protein 5) (PE) discontinued
035611-PE 200 µL

FGD3, CT (FGD3, ZFYVE5, FYVE, RhoGEF and PH domain-containing protein 3, Zinc finger FYVE domain-containing protein 5) (PE) discontinued

Sign In for Pricing
View Details
Anti Cassava G5 Pab Rat
100131 100 µg

Anti Cassava G5 Pab Rat

Sign In for Pricing
View Details
Recombinant Naegleria gruberi Flap endonuclease 1 (FEN1)
MBS1218242-01 0.02 mg (E-Coli)

Recombinant Naegleria gruberi Flap endonuclease 1 (FEN1)

Sign In for Pricing
View Details
Recombinant Naegleria gruberi Flap endonuclease 1 (FEN1)
MBS1218242-02 0.02 mg (Yeast)

Recombinant Naegleria gruberi Flap endonuclease 1 (FEN1)

Sign In for Pricing
View Details
Recombinant Naegleria gruberi Flap endonuclease 1 (FEN1)
MBS1218242-03 0.1 mg (E-Coli)

Recombinant Naegleria gruberi Flap endonuclease 1 (FEN1)

Sign In for Pricing
View Details