Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC14L2 Rabbit Polyclonal Antibody (Biotin)

SEC14L2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPF, TAP, TAP1, C22orf6

UniProt

O76054

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEC14L2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XDH Recombinant Monoclonal Antibody
CSB-RA785778A0HU-01 50 μL

XDH Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
XDH Recombinant Monoclonal Antibody
CSB-RA785778A0HU-02 100 µL

XDH Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (Azide free) (HRP) discontinued
038322-HRP 200 µL

MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-Human IgG
DB 173-0.5 500 µL

Anti-Human IgG

Sign In for Pricing
View Details
TIGAR Rabbit Polyclonal Antibody (PE)
orb495326 100 µL

TIGAR Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
TNFRSF11A Antibody (Biotin)
orb239752-01 50 µg

TNFRSF11A Antibody (Biotin)

Sign In for Pricing
View Details