Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP95 Rabbit Polyclonal Antibody (Biotin)

ZFP95 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZFP95, ZFP-95, ZNF914, ZSCAN37

UniProt

Q9Y2L8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_055384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC681801 3'UTR GFP Stable Cell Line
TU260811 1.0 mL

LOC681801 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RSV antibody
10-R25E 0.2 mg

RSV antibody

Sign In for Pricing
View Details
SEC24D (NM_014822) Human Tagged ORF Clone Lentiviral Particle
RC207747L2V 200 µL

SEC24D (NM_014822) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)
MBS7021598-01 0.02 mg

Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details
Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)
MBS7021598-02 0.1 mg

Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details
Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)
MBS7021598-03 5x 0.1 mg

Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details