Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTF1A Rabbit Polyclonal Antibody (Biotin)

PTF1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P48, PACA, PAGEN2, bHLHa29, PTF1-p48

UniProt

Q7RTS3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PTF1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_835455

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAP27.1 Rabbit Polyclonal Antibody (BF750)
orb2458721 100 µL

KAP27.1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)
MBS2121433-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)
MBS2121433-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)
MBS2121433-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)
MBS2121433-04 1 mL

Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)
MBS2121433-05 5 mL

Cy3-Linked Polyclonal Antibody to Pancreatic Elastase 1 (ELA1)

Sign In for Pricing
View Details