Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDEF Rabbit Polyclonal Antibody (HRP)

SPDEF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PDEF, bA375E1.3

UniProt

O95238

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEXM Antibody, FITC conjugated
A56506-100UG 100 µg

LEXM Antibody, FITC conjugated

Sign In for Pricing
View Details
CCL3 Antibody
orb1216818-01 20 µg

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
orb1216818-02 100 µg

CCL3 Antibody

Sign In for Pricing
View Details
NPC2 Peptide
DF7331-BP 1 mg

NPC2 Peptide

Sign In for Pricing
View Details
1810037I17Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4053602 1.0 µg DNA

1810037I17Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Na+ CP type Iβ Double Nickase Plasmid (m)
sc-422819-NIC 20 µg

Na+ CP type Iβ Double Nickase Plasmid (m)

Sign In for Pricing
View Details