Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDEF Rabbit Polyclonal Antibody (HRP)

SPDEF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PDEF, bA375E1.3

UniProt

O95238

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBP2 Protein Lysate
OCOA19595-20UG 20 µg

PCBP2 Protein Lysate

Sign In for Pricing
View Details
RUFY1 (NM_001040451) Human Tagged ORF Clone
RG207465 10 µg

RUFY1 (NM_001040451) Human Tagged ORF Clone

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2150644-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2150644-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2150644-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2150644-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details