Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF194 Rabbit Polyclonal Antibody (Biotin)

C20ORF194 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C20orf194

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C20ORF194

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

XP_045421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated CD15 Recombinant Rabbit Monoclonal Antibody [PD00-42]
HA720195F 100 µL

FITC Conjugated CD15 Recombinant Rabbit Monoclonal Antibody [PD00-42]

Sign In for Pricing
View Details
MMP14 Goat Polyclonal Antibody
AP32815PU-N 100 µg

MMP14 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF405S conjugate, 0.1mg/mL
BNC041906-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGP1 (MFAP2) (N-term) Rabbit Polyclonal Antibody
AP52678PU-N 400 µL

MAGP1 (MFAP2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGCT (C-term) Rabbit Polyclonal Antibody
AP51827PU-N 400 µL

GGCT (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-01 50 μL

CCL16 Antibody

Sign In for Pricing
View Details