Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF5L Rabbit Polyclonal Antibody (HRP)

TAF5L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAF65B

UniProt

O75529

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF5L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit
MBS8806092-01 48 Well

Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit

Sign In for Pricing
View Details
Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit
MBS8806092-02 96 Well

Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit

Sign In for Pricing
View Details
Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit
MBS8806092-03 5x 96 Well

Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit

Sign In for Pricing
View Details
Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit
MBS8806092-04 10x 96 Well

Rat PDGFD (Platelet Derived Growth Factor D) ELISA Kit

Sign In for Pricing
View Details
EGLN2 293 Cell Lysate
404840 0.1 mg

EGLN2 293 Cell Lysate

Sign In for Pricing
View Details
FOXP2 CRISPR Activation Plasmid (m)
sc-431094-ACT 20 µg

FOXP2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details