Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF777 Rabbit Polyclonal Antibody (FITC)

ZNF777 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA1285

UniProt

Q9ULD5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZN777

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IKTEEQDEEEEEEEEDELPQHLQSLGQLSGRYEASMYQTPLPGEMSPEGE

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005250038

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microloop Wire 3.57mm ID 5ul
INO2202 25 / PCK

Microloop Wire 3.57mm ID 5ul

Sign In for Pricing
View Details
Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial
MBS7096578-01 0.02 mg (E-Coli)

Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial

Sign In for Pricing
View Details
Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial
MBS7096578-02 0.1 mg (E-Coli)

Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial

Sign In for Pricing
View Details
Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial
MBS7096578-03 0.02 mg (Yeast)

Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial

Sign In for Pricing
View Details
Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial
MBS7096578-04 0.1 mg (Yeast)

Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial

Sign In for Pricing
View Details
Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial
MBS7096578-05 0.02 mg (Baculovirus)

Recombinant Human Probable G-protein coupled receptor 146 (GPR146), partial

Sign In for Pricing
View Details