Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKX Rabbit Polyclonal Antibody (HRP)

MKX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IFRX, IRXL1, C10orf48

UniProt

Q8IYA7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MKX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775847

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccnf shRNA (UAS) - Lentiviral mouse Ccnf shRNA (UAS, iRFP) plasmid
GTR15191344 1 Vial

Lentiviral mouse Ccnf shRNA (UAS) - Lentiviral mouse Ccnf shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SRPRB antibody
70R-1768 100 µL

SRPRB antibody

Sign In for Pricing
View Details
Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)
MBS1355018-01 0.02 mg (E-Coli)

Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)
MBS1355018-02 0.1 mg (E-Coli)

Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)
MBS1355018-03 0.02 mg (Yeast)

Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)
MBS1355018-04 0.1 mg (Yeast)

Recombinant Thermus aquaticus Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details