Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C13ORF8 Rabbit Polyclonal Antibody (FITC)

C13ORF8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1

UniProt

Q96JM3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C13ORF8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_115812

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR64, NT (WDR64, WD repeat-containing protein 64) (Azide free) (HRP)
MBS6363383-01 0.2 mL

WDR64, NT (WDR64, WD repeat-containing protein 64) (Azide free) (HRP)

Sign In for Pricing
View Details
WDR64, NT (WDR64, WD repeat-containing protein 64) (Azide free) (HRP)
MBS6363383-02 5x 0.2 mL

WDR64, NT (WDR64, WD repeat-containing protein 64) (Azide free) (HRP)

Sign In for Pricing
View Details
PREPL Rabbit Polyclonal Antibody
TA366443 100 µL

PREPL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat ATP Binding Cassette Transporter C4 (ABCC4) ELISA Kit
YP-W31721-01 48 Tests

Rat ATP Binding Cassette Transporter C4 (ABCC4) ELISA Kit

Sign In for Pricing
View Details
Rat ATP Binding Cassette Transporter C4 (ABCC4) ELISA Kit
YP-W31721-02 96 Tests

Rat ATP Binding Cassette Transporter C4 (ABCC4) ELISA Kit

Sign In for Pricing
View Details
CCNH siRNA (Rat)
orb1831332-01 15 nmol

CCNH siRNA (Rat)

Sign In for Pricing
View Details