ZNF326 Rabbit Polyclonal Antibody (HRP)
ZNF326 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
ZIRD, ZAN75, Zfp326, dJ871E2.1
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF326
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: ENPFEIQDHSQDQQIEGDEEDEEKIDEPIEEEEDEDEEEEAEEVGEVEEV
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
43kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Tested Applications
WB
NCBI Accession Number
NP_861446
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS629826-01 0.2 mL
SIL1, ID (Nucleotide Exchange Factor SIL1, BiP-associated Protein, BAP, UNQ545/PRO836)
Sign In for Pricing
View Details MBS629826-02 5x 0.2 mL
SIL1, ID (Nucleotide Exchange Factor SIL1, BiP-associated Protein, BAP, UNQ545/PRO836)
Sign In for Pricing
View Details 
MBS6283767-01 0.2 mL
CDC23, NT (CDC23, ANAPC8, Cell division cycle protein 23 homolog, Anaphase-promoting complex subunit 8, Cyclosome subunit 8) (FITC)
Sign In for Pricing
View Details MBS6283767-02 5x 0.2 mL
CDC23, NT (CDC23, ANAPC8, Cell division cycle protein 23 homolog, Anaphase-promoting complex subunit 8, Cyclosome subunit 8) (FITC)
Sign In for Pricing
View Details