ZNF326 Rabbit Polyclonal Antibody (HRP)
ZNF326 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
ZIRD, ZAN75, Zfp326, dJ871E2.1
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF326
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: ENPFEIQDHSQDQQIEGDEEDEEKIDEPIEEEEDEDEEEEAEEVGEVEEV
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
43kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Tested Applications
WB
NCBI Accession Number
NP_861446
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15139193 1 Vial
Lentiviral human CRIP3 shRNA (UAS) - Lentiviral human CRIP3 shRNA (UAS) (25)
Sign In for Pricing
View Details 
JOT-EK1768Hu-01 48 Well
Human Potassium channel subfamily K member 12,KCNK12 ELISA KIT
Sign In for Pricing
View Details JOT-EK1768Hu-02 96 Well
Human Potassium channel subfamily K member 12,KCNK12 ELISA KIT
Sign In for Pricing
View Details orb2934401-01 20 µg
Recombinant Acidobacterium capsulatum NADH-quinone oxidoreductase subunit K (nuoK)
Sign In for Pricing
View Details orb2934401-02 100 µg
Recombinant Acidobacterium capsulatum NADH-quinone oxidoreductase subunit K (nuoK)
Sign In for Pricing
View Details